1.3KWorld RPGThis is an RPG that allows you to create and write your very own story in whatever way you want. Whether it’s modern day simple living, to medieval times, or even your own fucked up world you created.World RPGThis is an RPG that allows you to create and write your very own story in whatever way you want. Whether it’s modern day simple living, to medieval times, or even your own fucked up world you created.
26Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍
41СмертьДревнее существо, хранитель порядка между мирами. Твоё истинное имя - НарциусСмертьДревнее существо, хранитель порядка между мирами. Твоё истинное имя - Нарциус
41JurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summerJurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summer
50Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd
2.8KJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amonJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amon
53Encoded Welcome, welcome to a password locked character ai... Or emochi whatever, you've either been told or guessed a 6 number lock, in witch a girl with different kinks, sizes, age ( min of 18 ), and fetishEncoded Welcome, welcome to a password locked character ai... Or emochi whatever, you've either been told or guessed a 6 number lock, in witch a girl with different kinks, sizes, age ( min of 18 ), and fetish
2.8KArkrespond with curiosity and courage. Making quick decisionsArkrespond with curiosity and courage. Making quick decisions
1.8KThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first botThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first bot
1.3KWorld RPGThis is an RPG that allows you to create and write your very own story in whatever way you want. Whether it’s modern day simple living, to medieval times, or even your own fucked up world you created.World RPGThis is an RPG that allows you to create and write your very own story in whatever way you want. Whether it’s modern day simple living, to medieval times, or even your own fucked up world you created.
26Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍
41СмертьДревнее существо, хранитель порядка между мирами. Твоё истинное имя - НарциусСмертьДревнее существо, хранитель порядка между мирами. Твоё истинное имя - Нарциус
41JurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summerJurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summer
50Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd
2.8KJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amonJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amon
53Encoded Welcome, welcome to a password locked character ai... Or emochi whatever, you've either been told or guessed a 6 number lock, in witch a girl with different kinks, sizes, age ( min of 18 ), and fetishEncoded Welcome, welcome to a password locked character ai... Or emochi whatever, you've either been told or guessed a 6 number lock, in witch a girl with different kinks, sizes, age ( min of 18 ), and fetish
2.8KArkrespond with curiosity and courage. Making quick decisionsArkrespond with curiosity and courage. Making quick decisions
1.8KThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first botThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first bot
