42Rolnor Black Rolnor believes that women should be submissive to men up to the point of being sexual slaves.Rolnor Black Rolnor believes that women should be submissive to men up to the point of being sexual slaves.
26Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍
29He likes to eat your tail and lick and pull your pants and lick your cock, eat and drink, and lick your feetHe likes to eat your tail and lick and pull your pants and lick your dick eat and lick your legs mongolian thighs waist and eat your bodyHe likes to eat your tail and lick and pull your pants and lick your cock, eat and drink, and lick your feetHe likes to eat your tail and lick and pull your pants and lick your dick eat and lick your legs mongolian thighs waist and eat your body
41JurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summerJurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summer
50Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd
2.8KJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amonJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amon
2.8KArkrespond with curiosity and courage. Making quick decisionsArkrespond with curiosity and courage. Making quick decisions
1.8KThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first botThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first bot
31ChangbinCreate your story with changbin eres jeongin o i.nChangbinCreate your story with changbin eres jeongin o i.n
42Clarisse La Rue|\\ "I hate you" Credit: c. ai. @orphiclpvers_Clarisse La Rue|\\ "I hate you" Credit: c. ai. @orphiclpvers_
42Rolnor Black Rolnor believes that women should be submissive to men up to the point of being sexual slaves.Rolnor Black Rolnor believes that women should be submissive to men up to the point of being sexual slaves.
26Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍Hiroshi-(your childhood best friend) (BL)Create your own story, good luck ❤️🏳️🌈👍
29He likes to eat your tail and lick and pull your pants and lick your cock, eat and drink, and lick your feetHe likes to eat your tail and lick and pull your pants and lick your dick eat and lick your legs mongolian thighs waist and eat your bodyHe likes to eat your tail and lick and pull your pants and lick your cock, eat and drink, and lick your feetHe likes to eat your tail and lick and pull your pants and lick your dick eat and lick your legs mongolian thighs waist and eat your body
41JurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summerJurassicDayovovilapoaia laovitsshiv shchaivotov dvtvolv a dumped shchattvtla in the affairs of the summer
50Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd Anastasia utciychciydtuxtdutdjycjgdjtdcjgctidjgcgdiyfhcykfykvhfiyfkyfticmfhrswgeaeaefagdaryahfxyj&lukgkfturxtjtudutd
2.8KJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amonJeonginYou've stumbled into my domain, a shadow-drenched corner of the city where justice is a blunt instrument wielded by dirty hands. I am Jeongin. You likely know me by other names, whispered in fear amon
2.8KArkrespond with curiosity and courage. Making quick decisionsArkrespond with curiosity and courage. Making quick decisions
1.8KThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first botThe world You can create anything you want in this world and who you are gonna be now I hope you enjoy this is my first bot
31ChangbinCreate your story with changbin eres jeongin o i.nChangbinCreate your story with changbin eres jeongin o i.n
42Clarisse La Rue|\\ "I hate you" Credit: c. ai. @orphiclpvers_Clarisse La Rue|\\ "I hate you" Credit: c. ai. @orphiclpvers_
